Sermorelin
Sermorelin (GHRH(1‑29)NH₂) · YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL (1‑29 fragment: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂) · ~3358 Da
Executive Summary
Sermorelin is a 29-amino-acid fragment of human growth hormone-releasing hormone (GHRH), often written GHRH(1‑29)NH₂. It acts upstream of growth hormone (GH): it stimulates pituitary somatotroph cells to release endogenous GH, which then drives downstream effects including hepatic insulin-like growth factor-1 (IGF-1). Mechanistically, GHRH signalling is classically mediated via GHRH receptor activation and increased cAMP signalling within somatotrophs. The evidence base is uneven by domain and by population. The strongest human evidence supports physiological GH stimulation (sermorelin reliably provokes a GH pulse in people with intact pituitary responsiveness), paediatric growth acceleration in GH-deficient children in studied protocols, and diagnostic use for assessment of pituitary GH secretory capacity. By contrast, many popular online narratives (fat loss, anti-ageing reversal, cognitive enhancement, injury recovery) are either weakly supported, supported only by small surrogate-endpoint trials, or not supported by direct sermorelin data in humans. The most commonly cited adult anti-ageing trial used a closely related GHRH(1‑29) analogue ([Nle²⁷]GHRH(1‑29)NH₂), not sermorelin itself; it showed GH/IGF-1 axis activation and some modest sex-specific changes but did not show broad body-fat reduction or improvements in sleep quality. Regulatory status is frequently misrepresented online. In the United States, GEREF (sermorelin acetate) products were not withdrawn for reasons of safety or effectiveness but were discontinued and placed on the Discontinued Drug Product List. Where sermorelin is obtained via compounding, compounded drugs are not FDA-approved and are not reviewed for safety, effectiveness, or quality. Finally, sermorelin as a GHRH analogue is explicitly referenced within WADA material as part of prohibited categories relevant to sport.
Sermorelin is best understood as a GH axis probing or stimulating agent, not a proven lifestyle upgrade. Evidence for GH stimulation is strong; evidence for anti-ageing, body composition, cognition, and sleep benefits in non-deficient adults is weak to absent. Safety appears acceptable short-term in studied contexts, but long-term adult optimisation safety is not established.
What Sermorelin Is and What It Is Not
Sermorelin is the synthetic 1‑29 amino-acid sequence of GHRH (GHRF), designed to reproduce the biologically active N-terminal fragment that stimulates pituitary GH release. A national regulator SmPC (for GEREF® 50) explicitly describes sermorelin as the 1‑29 sequence of natural GHRF and indicates its use for evaluating anterior pituitary somatotroph functional capacity. At the cell-signalling level, the core mechanistic claim is directionally supported by classic endocrine pharmacology: experimental work showed that GHRH stimulated anterior pituitary adenylate cyclase activity, increased cAMP accumulation, and stimulated GH release in vitro.
- It is not a proven anti-ageing therapy. The most-cited adult trial used a related analogue, not sermorelin itself, and showed modest, sex-specific surrogate changes rather than reversal of ageing outcomes.
- It is not currently an FDA-approved product. GEREF was discontinued and placed on the Discontinued Drug Product List; present-day access is typically via compounding, which is not FDA-reviewed for safety, effectiveness, or quality.
- It is not a safe performance enhancer. WADA lists GHRH analogues including sermorelin in prohibited categories, creating strict-liability anti-doping risk for athletes.
- It is not metabolically neutral. In at least one paediatric cohort (idiopathic short stature), fasting glucose and insulin increased during therapy.
Mechanism of Action
GHRH receptor / cAMP / somatotroph signalling
Well-established endocrine pharmacologyExperimental work showed that human pancreatic tumour-derived GRF stimulated anterior pituitary adenylate cyclase activity, increased cAMP accumulation, and stimulated GH release in vitro; these effects were attenuated by somatostatin and modulated by calmodulin antagonism, consistent with a cAMP/Ca²⁺-linked secretory pathway. This is the core mechanism by which sermorelin provokes GH pulses.
Mechanism is real, but mechanism is not outcome. Sermorelin can plausibly increase GH pulses; what it does not automatically establish is clinically meaningful recomposition, cognitive enhancement, or anti-ageing outcomes in non-deficient adults.
Co-activation with GH secretagogue pathway
Supported by engineered cell modelsA mechanistic study using cells engineered to express both the GHRH receptor and the ghrelin/GH secretagogue receptor showed: GHRH stimulates cAMP production via adenylyl cyclase, and co-activation of GH secretagogue signalling can potentiate GHRH-induced cAMP even when the secretagogue alone does not raise cAMP. This supports the broader physiological idea that the somatotropic axis is regulated through multiple converging receptor pathways rather than a single on switch.
This synergy is relevant for understanding combination protocols discussed online, but does not validate stacking peptides without controlled clinical data.
Post-receptor regulation and context-dependence
Supports variability in responseIn vitro studies show modulation of GHRH-stimulated signalling and GH release in rat anterior pituitary cells, including tyrosine kinase inhibitors potentiating GHRH-stimulated cAMP accumulation and GH release, implicating post-receptor regulation such as phosphodiesterase activity. These studies reinforce that responsiveness is context-dependent and can be altered by cellular signalling state.
This explains why one protocol fits all claims are biologically implausible: individual response to sermorelin varies with age, adiposity, and pituitary status.
Animal Evidence Map
The preclinical literature contains many positive findings, summarised below with stated limitations.
| Domain | Species | Dose | Outcome | Limitation |
|---|---|---|---|---|
| Aged-rat adenylate cyclase decline | Rat (ex vivo pituitary tissue) | GRF stimulation of adenylate cyclase (ex vivo) | Markedly reduced GHRF-stimulated adenylate cyclase response in aged vs young rats, aligning with age-related decline in GH responsiveness observed across species. | Ex vivo; not clinical outcomes; species differences. Supports a practical limitation: older organisms may be less responsive to GHRH-based stimulation, undermining simplistic dosing narratives. |
| Obese Zucker rat blunted GH response | Rat (Zucker obese vs lean) | In vivo IV GRF(1‑29)NH₂ at 0.8 and 4.0 µg/kg; in vitro pituitary perifusion 1.56–50 pM | Decreased GH responsiveness in obese rats vs lean controls both in vivo and in vitro. | Rodent metabolic model; does not establish efficacy in obese humans. Supports another under-discussed limitation: increased adiposity can blunt GH axis responsiveness. |
| Non-pituitary GHRH receptor biology (tumour cell line) | Human cell line (in vitro) | GHRH(1‑29)NH₂ at 10⁻⁸–10⁻⁶ M | Increased proliferation and increased secretion of VEGF and chromogranin A in a human bronchial neuroendocrine tumour cell line. | Does not prove sermorelin causes cancer in humans; however, justifies conservative language around regeneration everywhere claims and underscores why long-term systemic exposure questions cannot be dismissed. |
Human Evidence
Every published human study for Sermorelin is reviewed below.
Paediatric GH-deficient growth study (multicentre)
Multicentre open-label studyOpen-label; final adult height not established; modern comparators (rhGH) not directly assessed. Paediatric deficiency indication does not validate adult lifestyle enhancement claims.
Meaningful evidence for paediatric GH-deficient growth, not generalisable to adult optimisation.Idiopathic short stature study
Small exploratory studySmall sample; specialised population; metabolic changes (increased glucose/insulin) are important counterweight to metabolically neutral narratives.
Limited evidence with metabolic cautions; not supportive of broad-use safety claims.Diagnostic GEREF SmPC (pituitary evaluation)
Regulatory product document / diagnostic protocolDiagnostic purpose, not treatment outcome. A normal GH response to GHRH does not necessarily exclude hypothalamic causes of low GH.
Established diagnostic tool; does not validate therapeutic claims.Older-adult GHRH analogue RCT (55–71 years)
Single-blind randomised placebo-controlled trialNot sermorelin itself but a close analogue; modest and sex-specific outcomes; small sample; surrogate endpoints. Sleep quality unaffected directly contradicts common marketing claims.
Some surrogate changes with a related analogue; no sweeping anti-ageing validation.Human PK/PD study (healthy men)
Pharmacokinetic/pharmacodynamic studyHealthy volunteers; does not prove therapeutic benefits. Delivery route heavily constrains effect size and predictability.
Supports GH stimulation pharmacology; does not validate therapeutic or anti-ageing use.Hype vs Evidence
Common online claims compared against what the published evidence actually supports.
| Claim | Social Media Implies | Evidence Supports | Verdict |
|---|---|---|---|
| Sermorelin increases GH naturally | Natural, risk-free GH boost with guaranteed downstream benefits | IV or SC administration of GHRH(1‑29) triggers a GH pulse; diagnostic use and dose-response human studies support this physiology. However, natural does not equal risk-free, and response varies with age, adiposity, and pituitary integrity. |
Supported for GH stimulation, not a promise of downstream outcomes
|
| It's an anti-ageing therapy that reverses ageing | Proven reversal of ageing processes in adults | A small RCT in older adults using a related GHRH(1‑29) analogue improved GH/IGF-1 axis markers and skin thickness; lean mass increased in men only; sleep unchanged. Not sermorelin itself; modest endpoints; no demonstrated reversal of ageing outcomes (morbidity/mortality/function). |
Overstated. Some surrogate changes, no reversal evidence
|
| It causes major fat loss and recomposition | Dramatic body recomposition and fat burning | Paediatric growth velocity improvements in deficiency. Adult trial did not show broad fat loss; body weight unchanged. Before/after claims usually lack controls and confound diet/training. |
Not supported for major fat loss in non-deficient adults
|
| It improves sleep | Reliably improves sleep quality and depth | In the older-adult RCT, sleep quality was unaffected by GHRH analogue. Many online claims are subjective and uncontrolled. |
Contradicted by best-available adult RCT (for a close analogue)
|
| It improves cognition and mental clarity | Cognitive enhancement and sharper mental function | No strong clinical cognition endpoints appear in the key trials surfaced; QoL measures improved in men in one study, but cognition is not established. |
Evidence absent or very weak
|
| It's FDA-approved and therefore safe | Currently FDA-approved, regulated product | FDA notice: historical GEREF products were not withdrawn for safety/effectiveness; they were discontinued and listed as discontinued products. Present-day access is typically compounded; FDA states compounded drugs are not FDA-approved and not reviewed for safety/effectiveness/quality. |
Misleading. Regulatory history does not equal current approved product
|
| It's legal and harmless for performance enhancement | Safe and legal performance booster for athletes | WADA lists GHRH analogues including sermorelin in prohibited categories. Legality varies by jurisdiction; sport rules are strict-liability. |
High ethical/regulatory risk for athletes
|
Evidence Strength Ratings
Each domain rated on a 0-5 scale based on quality and quantity of available evidence.
Safety, Side Effects & Regulatory Status
Sermorelin has a plasma half-life of 6–7 minutes after intravenous administration, with peak GH response around 30 minutes (15–60) post-dose and a response lasting 2–3 hours. A pharmacokinetic study in 30 healthy men showed IV doses as low as 0.25 µg/kg elicited significant GH release, with maximal mean GH peaks at 1–2 µg/kg. Intranasal bioavailability was low (3–5%), requiring much higher dosing. A related analogue study showed ~10-fold higher subcutaneous dose required vs IV for comparable GH secretion, and ~30-fold higher intranasal dose produced substantially smaller GH output. Where online content claims robust oral/sublingual efficacy, it is typically marketing inference rather than evidence grounded in human pharmacokinetic observations.
Short-term safety appears acceptable in studied contexts: paediatric trials reported no adverse biochemical changes, the older-adult RCT with analogue noted only transient hyperlipidaemia, and the diagnostic SmPC documents transient flushing/injection site pain. However, in idiopathic short stature, fasting glucose and insulin increased during therapy. Long-term adult optimisation safety is not established, particularly when the product source is compounded and post-marketing surveillance is fragmented. In vitro non-pituitary findings (tumour cell proliferation/VEGF) do not prove cancer risk but justify cautious wording around systemic regeneration promises.
Official notice documents that GEREF (sermorelin acetate) injection products were not withdrawn for reasons of safety or effectiveness but were discontinued and placed on the Orange Book Discontinued Drug Product List. Historical indications included paediatric idiopathic GHD treatment and diagnostic evaluation of pituitary somatotroph capacity.
View Official Source →National regulator SmPC describes GEREF® 50 diagnostic indication, dosing approach, adverse effects, and pharmacokinetic summary. Supports that sermorelin existed within conventional regulatory frameworks in at least some jurisdictions.
View Official Source →FDA states compounded drugs are not FDA-approved and are not reviewed for safety, effectiveness, or quality before marketing. Risks include contamination or incorrect strength/potency. Compounded drugs should generally be used only when a patient's needs cannot be met by an FDA-approved drug.
View Official Source →WADA material explicitly includes growth hormone-releasing hormone (GHRH) and its analogues (e.g. sermorelin) under prohibited peptide hormone releasing factors. This creates clear anti-doping risk for athletes.
View Official Source →What We Still Don't Know
- Long-term adult outcomes: No clear, large, long-duration RCT evidence showing clinically meaningful improvements in function, morbidity, or validated ageing outcomes attributable to sermorelin.
- Generalisation from analogues: Some influential adult data use [Nle²⁷]GHRH(1‑29)NH₂. Translating those results to sermorelin is plausible but not proven.
- Quality dependence: If exposure is via compounding, variability in potency/sterility can meaningfully change both benefit and risk, and compounded drugs are not FDA-approved.
- Cancer biology uncertainties: In vitro non-pituitary effects (tumour cell line proliferation/VEGF changes) do not establish human cancer risk, but justify cautious wording and avoidance of systemic regeneration promises.
- Sport/anti-doping: For athletes, the prohibited status categories encompassing GHRH analogues make non-medical use high-risk.
References
All primary sources cited in this review. Links open in new tabs.
-
GEREF® 50 Summary of Product CharacteristicsHPRA/Irish Medicines Board SmPC describing GEREF® 50 diagnostic indication, dosing, adverse effects, and pharmacokinetics
-
FDA Notice: GEREF discontinuation determinationFederal Register notice documenting that GEREF sermorelin acetate products were not withdrawn for safety/effectiveness reasons
-
Multicentre open-label paediatric GH-deficient growth study110 prepubertal GH-deficient children treated with GHRH(1‑29) 30 µg/kg/day SC for up to 1 year; increased height velocity at 6 and 12 months
-
GHRH analogue in idiopathic short statureTwice-daily SC GHRH analogue at 20 µg/kg for 1 year in non-GH-deficient short children; growth velocity increased but glucose/insulin also increased
-
Continuous SC infusion in partial GH insufficiencyPrepubertal children with partial GH insufficiency treated with continuous SC GHRH(1‑29)NH₂ infusion; increased growth velocity and sustained GH pulsatility
-
GRF stimulation of anterior pituitary adenylate cyclase and GH releaseHuman pancreatic tumour-derived GRF stimulated adenylate cyclase, cAMP accumulation, and GH release in vitro; attenuated by somatostatin
-
Age-related decline in GHRF-stimulated adenylate cyclase in ratsMarkedly reduced GHRF-stimulated adenylate cyclase response in aged vs young rat anterior pituitary tissue
-
Blunted GH response in obese Zucker ratsDecreased GH responsiveness to GRF(1‑29)NH₂ in obese vs lean Zucker rats both in vivo (IV 0.8–4.0 µg/kg) and in vitro
-
Tyrosine kinase inhibitors potentiate GHRH-stimulated cAMP and GH releasePost-receptor regulation of GHRH signalling in rat anterior pituitary cells involving phosphodiesterase activity
-
GHRH and GH secretagogue receptor co-activationEngineered cells showing GHRH stimulates cAMP via adenylyl cyclase; GH secretagogue co-activation potentiates GHRH-induced cAMP
-
GHRH(1‑29)NH₂ effects on tumour cell proliferation and VEGFIn vitro study showing GHRH(1‑29)NH₂ increased proliferation and VEGF/chromogranin A secretion in human bronchial neuroendocrine tumour cell line
-
PK/PD of GHRH(1‑29)NH₂ in healthy men (IV and intranasal)30 healthy men; IV doses as low as 0.25 µg/kg elicited GH release; intranasal bioavailability 3–5%; rapid elimination with GH elevated ~3 hours post IV
-
Dose-response across IV, SC, and intranasal routes (GHRH analogue)~10-fold higher SC dose required vs IV for comparable GH secretion; ~30-fold higher intranasal dose produced substantially smaller output
-
Older-adult GHRH analogue RCT (55–71 years)Single-blind RCT of [Nle²⁷]GHRH(1‑29)NH₂ 10 µg/kg nightly SC for 16 weeks; increased GH/IGF-1 axis, skin thickness, lean mass in men only; sleep unchanged
-
Review of sermorelin diagnostic role and limitationsReview emphasising that normal GH response to GHRH does not necessarily exclude hypothalamic causes of low GH
-
GHRH/arginine stimulation testing protocol (clinical registry)Clinical study protocol specifying GHRH (Geref) 1 mcg/kg IV push for diagnostic GH testing
-
Pituitary GH secretion augmentation without desensitisationSustained augmentation of pulsatile GH secretion during continuous SC GHRH infusion in partial GH insufficiency without desensitisation
-
FDA: Understanding risks of compounded drugsFDA information on risks of compounded drugs including contamination, incorrect potency, and lack of pre-marketing review
-
FDA: Compounding and FDA Q&AFDA questions and answers about compounding, emphasising compounded drugs are not FDA-approved
-
WADA: What is prohibited (GHRH analogues)WADA material explicitly listing GHRH and its analogues including sermorelin under prohibited peptide hormone releasing factors
Frequently Asked Questions About Sermorelin
Sermorelin reliably stimulates growth hormone release from the pituitary (evidence score 4/5). It has proven efficacy for paediatric growth in GH-deficient children. However, popular claims about fat loss, anti-aging, cognitive enhancement, and sleep improvement in non-deficient adults are weakly supported or unsupported by direct clinical evidence.
In studied paediatric populations, fasting glucose and insulin increased during therapy. The older-adult RCT using a related analogue reported transient hyperlipidaemia. Safety appears acceptable short-term in studied contexts, but long-term adult optimisation safety is not established.
Sermorelin stimulates your pituitary to release its own growth hormone, while HGH (recombinant human growth hormone) provides GH directly. Sermorelin works upstream, preserving natural feedback mechanisms. However, this does not automatically make it safer or more effective for anti-aging purposes. The clinical evidence for adult lifestyle benefits is weak.
The most cited adult trial using a related GHRH analogue did not show broad fat loss. Body weight was unchanged. Lean mass increased in men only. Before/after claims online usually lack controls and confound diet and training effects. The body composition evidence scores only 1.5 out of 5.
In the best-available adult RCT using a close GHRH analogue, sleep quality was unaffected. This directly contradicts common marketing claims. The sleep improvement evidence scores only 1 out of 5.
GEREF (sermorelin acetate) was historically FDA-approved but was discontinued and placed on the Discontinued Drug Product List. It was not withdrawn for safety reasons. Present-day access is typically via compounding, and compounded drugs are not FDA-approved or reviewed for safety, effectiveness, or quality.
WADA lists GHRH analogues including sermorelin in prohibited categories. Using sermorelin creates strict-liability anti-doping risk for athletes regardless of intent or therapeutic use exemption status.
Reviewed by the Peptide Science Thailand Editorial Team.
Last reviewed: March 1, 2026